LL37
Product details
LL-37 is the only human cathelicidin antimicrobial peptide, consisting of 37 amino acids with an amphipathic α-helical structure. This endogenous peptide plays crucial roles in innate immunity and has demonstrated broad-spectrum antimicrobial activity.
Research Applications: - Antimicrobial mechanism studies - Biofilm disruption research - Wound healing and tissue repair - Immunomodulation pathways - Anti-viral activity research - Chemotaxis and cytokine induction
Molecular Information: - Sequence: [LL-37, 37 aa] - Molecular Formula: C205H340N60O53 - Molecular Weight: 4493.3 g/mol - Purity: >99% (HPLC verified)
Form: Lyophilized powder Storage: Store at -20°C. Protect from light.
For research use only. Not for human or veterinary use. By purchasing, you confirm that this product will be used only for legitimate in-vitro research.